PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G13160.1
Common NameLOC102710177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 681aa    MW: 76023.6 Da    PI: 7.0859
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G13160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-09447492752
                   --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
      Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                   + +  +e+L ++F++n  p ++ +e L+++lg++ +++  WF+N R
  OB02G13160.1 447 IPPAAVEVLRKAFAENELPARSVKENLSTELGISFEKIDKWFKNTR 492
                   567789**************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579037.2E-10182253IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.0E-8194250IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500169.499195251IPR019787Zinc finger, PHD-finger
SMARTSM002491.6E-5197249IPR001965Zinc finger, PHD-type
Gene3DG3DSA:1.10.10.603.1E-11433492IPR009057Homeodomain-like
SuperFamilySSF466898.13E-10436497IPR009057Homeodomain-like
PROSITE profilePS5007112.276438498IPR001356Homeobox domain
SMARTSM003893.8E-9440502IPR001356Homeobox domain
CDDcd000861.46E-8441502No hitNo description
PfamPF000461.0E-6446492IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MHTPENKPLC YTSRRSSQQR TGSSSELIPV SKRATRQNTS LKPDSPPKRT TRSSAKLAKC  60
IKNKHDCSPL KHRQGSGAAT GNSATGPIRR KHKQKRNNNE CDEVTRMEKR ARYLLIKIKQ  120
EQNLLDAYSG DGWNGHSREK LKPEKELQRA KKQIMKYKIA IRDVIHQLDL CTSNGTKDDS  180
MMPPDGCHES VNAHHTICSR CNSHESFPDN NIIFCEGSCK RAYHQKCLEP PFDKILSTTR  240
HGQLCKYCFS KIKILEAINA HLGTSFTTKC PSNDIFKEAT EYLDSDNGLG EDWLSEYSGD  300
EDYDPEENEA SSSSAEENKS ADSNCSGSPL YSPNDDIPDF ISADFNEAEG FCHDSSNLGI  360
DFGEDGLAEI LTYQRPRRDV DYTQLNEQMF GEPIGNGEPS EDEDWGLNRR KKRRTGSTGA  420
GTNSVVDLSD AISKEKVKPQ RRKLFRIPPA AVEVLRKAFA ENELPARSVK ENLSTELGIS  480
FEKIDKWFKN TRCAALRDRK GEGRNSGPSK KSRTSIEKAE TSAKVDQMDN SCFLPLSEII  540
NVPTRLQKSI DRKPKSTSSP PRSHDDEACL SPNGNIKESV PPAIKPSMAD SSQLTNNNIG  600
TETAVSWVDT WASDALHFLD VSDDEHFFDV IEKVCGLEHR LQRLKENMLS SSSSTDNNVA  660
AENGLQNQVV LVPAAELKDK S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0652570.0AK065257.1 Oryza sativa Japonica Group cDNA clone:J013002J16, full insert sequence.
GenBankAK0705020.0AK070502.1 Oryza sativa Japonica Group cDNA clone:J023051F17, full insert sequence.
GenBankAK0988550.0AK098855.1 Oryza sativa Japonica Group cDNA clone:J013000I05, full insert sequence.
GenBankFJ9402070.0FJ940207.1 Oryza sativa Japonica Group clone KCS002D03 homeodomain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646881.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLJ3L9J90.0J3L9J9_ORYBR; Uncharacterized protein
STRINGOB02G13160.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.13e-55pathogenesis related homeodomain protein A